PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400021797
Common NameLOC102581040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 229aa    MW: 26170.6 Da    PI: 9.2194
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400021797genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.5e-32149207159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDg++WrKYGqK vk+s++prsYYrCt+++C+vkk+++r ++d+++v++tYeg Hnh+
  PGSC0003DMP400021797 149 LDDGFKWRKYGQKAVKNSTHPRSYYRCTHHTCNVKKQIQRLSKDTSIVVTTYEGIHNHP 207
                           59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-32136207IPR003657WRKY domain
SuperFamilySSF1182904.84E-28141208IPR003657WRKY domain
PROSITE profilePS5081128.116144209IPR003657WRKY domain
SMARTSM007745.9E-37149208IPR003657WRKY domain
PfamPF031062.6E-25150207IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MHYNNSTLLS MDAREELPPP PPPPLPPLTL LSPANFFMQQ PNDQLAMQNN CNSSQVGLIC  60
DNIDWAGLLS GSSSINNNNE SIATTSNVSI NPRNMNMNMN TNTNMNMMEG GEQHQQQLQE  120
HNFRRDKGRK RKYVPPRVAF HTRSTEDILD DGFKWRKYGQ KAVKNSTHPR SYYRCTHHTC  180
NVKKQIQRLS KDTSIVVTTY EGIHNHPCEK LMETLSPILK QLQFLSRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-24137206271WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343925.11e-172PREDICTED: probable WRKY transcription factor 56
TrEMBLM1AWU51e-172M1AWU5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000320901e-172(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63742433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.11e-56WRKY DNA-binding protein 56
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]